DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPB13

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_314336.2 Gene:CLIPB13 / 1275070 VectorBaseID:AGAP004855 Length:410 Species:Anopheles gambiae


Alignment Length:281 Identity:79/281 - (28%)
Similarity:129/281 - (45%) Gaps:43/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FQMLLEEDCG-IPHNISERSVNAKLAQNPWMAYLETPK----GFHCSGTLINHLFVLTAAHCVPD 80
            :.:|...:|| |..|........::.:.|||..|....    ...|.|:|||:.:||||||||..
Mosquito   135 WNLLPTRNCGTITVNRIAHGNTTRVFEYPWMVLLRYESNGVLSDRCGGSLINNRYVLTAAHCVRT 199

  Fly    81 D---LLITVRLGEYNTKTKVDCDNHL-------CQEPFQEYNVDMGFRHRYYNANDQ-TNDIGML 134
            .   .|:.|||||::.:.::||  |:       |.:|..:.:::....|:.||...: .:||.:|
Mosquito   200 SSSIRLVKVRLGEHDKRQQIDC--HVYSDGEKDCADPAVDVDIESMIVHKDYNRPIKFRHDIALL 262

  Fly   135 RLGRRVEYLNHIRPICIFASNRFQEPIDQ------LTWFTTTVWRETAANATSKVLRTMNIDRQP 193
            |:.:.||:.:.::|||:        |:::      |..:..|.|..|...:.|.:|....::..|
Mosquito   263 RMAQEVEFSDSVKPICL--------PVNEDVRRKVLPKYIITGWGTTEQQSLSDLLLQAIVNHVP 319

  Fly   194 KETCSEIYGWNMTFE------QIC-AGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIAS---R 248
            ...|.:....|..:.      |:| ||..|...|..|||.|....:...|: ::||.||.|   |
Mosquito   320 VPECQQKMNENFLYVTLADEWQMCAAGEGLVDSCQGDSGGPLGFSVDVAGA-KFVQFGIVSAGVR 383

  Fly   249 VKGQCQNSGILMDLLSYADWI 269
            ..|:....||...:.||.:||
Mosquito   384 SCGKESVPGIYTRVTSYMNWI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 74/253 (29%)
Tryp_SPc 48..269 CDD:214473 72/251 (29%)
CLIPB13XP_314336.2 CLIP 28..81 CDD:288855
Tryp_SPc 150..404 CDD:214473 72/264 (27%)
Tryp_SPc 151..404 CDD:238113 72/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.