DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP005196

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_314095.2 Gene:AgaP_AGAP005196 / 1274902 VectorBaseID:AGAP005196 Length:264 Species:Anopheles gambiae


Alignment Length:210 Identity:54/210 - (25%)
Similarity:90/210 - (42%) Gaps:49/210 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 HCSGTLINHLFVLTAAHCVPD---DLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRY 121
            :|.|::|...::|||||||.:   ..|..||:|..        ||:   |....|.:|....|..
Mosquito    60 YCGGSIIAARWILTAAHCVTNVNVTNLTVVRVGTN--------DNY---EGGSMYQIDRVIPHER 113

  Fly   122 YNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTV-------WRETAANA 179
            |:|....||:.:|||...:::..|:..|.:   |....||:.    |.|:       |.:.....
Mosquito   114 YSAITFRNDVALLRLKTPIKFEEHVEKIEL---NEELVPINA----TLTIVGWGFVGWNKENPKR 171

  Fly   180 TSKVLRTMNIDRQPKETCSEIYGWNMTF-EQICAGNTLSQL----CSTDSGAPQIRKMWHNGSDR 239
            | :|::..:|.   ...|.::...:..: |.:|   |.|:.    |..|||:|.:   |     :
Mosquito   172 T-QVIKVQHIG---LNRCRKMANGSAIYPEHLC---TFSRAGHGPCKGDSGSPVV---W-----K 221

  Fly   240 YVQLGIAS-RVKGQC 253
            ..|:|:.| .:.|.|
Mosquito   222 GKQVGVVSWAMAGVC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 54/210 (26%)
Tryp_SPc 48..269 CDD:214473 54/210 (26%)
AgaP_AGAP005196XP_314095.2 Tryp_SPc 35..257 CDD:238113 54/210 (26%)
Tryp_SPc 35..254 CDD:214473 54/210 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.