DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP004568

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_313873.5 Gene:AgaP_AGAP004568 / 1274710 VectorBaseID:AGAP004568 Length:283 Species:Anopheles gambiae


Alignment Length:260 Identity:66/260 - (25%)
Similarity:104/260 - (40%) Gaps:40/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISE--RSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEY 91
            ||...|.|:  ....|::.:.|||..|.....|.|.|:|||..:||||||||         .|..
Mosquito    34 CGTNANNSKIVGGHEAEIGRYPWMVALYYNNRFICGGSLINDRYVLTAAHCV---------FGSD 89

  Fly    92 NTKTKVDC---DNHLCQEPFQEYNVDMGFRHRYYNA-NDQTNDIGMLRLGRRVEYLNHIRPICI- 151
            .::..|..   |..:.:|...|..|.....:.:.|. ...|||:.:|:|...|.....|.|:|: 
Mosquito    90 RSRFSVKFLMHDRTVPKEDSFERKVSYIMTNWFLNVLVFITNDVALLKLSEPVPLGETIIPVCLP 154

  Fly   152 -----FASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETC---SEIYGWNMTFE 208
                 :|.   ||.|       .|.|.:.........|:.:::.....|.|   ::.:.:.:...
Mosquito   155 PEGNTYAG---QEGI-------VTGWGKLGDGTFPMKLQEVHVPILSNEQCHNQTQYFRFQINDR 209

  Fly   209 QICAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKG--QCQNSGILMDLLSYADWI 269
            .:|||  ......|..|||.|.  .::...::|:|..|:.|...|  |.:..||...:..:..||
Mosquito   210 MMCAGIPEGGKDSCQGDSGGPM--HVFDTEANRFVIAGVVSWGFGCAQPRFPGIYARVNRFISWI 272

  Fly   270  269
            Mosquito   273  272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/239 (26%)
Tryp_SPc 48..269 CDD:214473 59/237 (25%)
AgaP_AGAP004568XP_313873.5 Tryp_SPc 42..272 CDD:214473 60/250 (24%)
Tryp_SPc 43..275 CDD:238113 62/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.