DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPC3

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_313589.2 Gene:CLIPC3 / 1274461 VectorBaseID:AGAP004318 Length:393 Species:Anopheles gambiae


Alignment Length:342 Identity:89/342 - (26%)
Similarity:131/342 - (38%) Gaps:97/342 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVICC-----LWRRVQGFQM---LLEEDCGIPHNISERSVN------------AKLAQNPWMAYL 53
            |::||     |.....||.:   |..:..|....|||:..|            :.|..||.:..:
Mosquito    70 AIVCCPQSQQLDSPPSGFSIPTPLNSQSRGGSERISEKKCNEYKDLTTESVAISALTLNPTLVKI 134

  Fly    54 ETPK----------------------------------GFHCSGTLINHLFVLTAAHCVPDD--- 81
            :.||                                  .|.|.|:||:..:|||||||..:.   
Mosquito   135 DVPKCEMVVKLIVGGNVTKPGEFPHMAAIGWRQPNGGYSFDCGGSLISEYYVLTAAHCYAESADG 199

  Fly    82 -LLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRH--------RYYNANDQTNDIGMLRLG 137
             |...|||||.:...:.|     ..|| :.|::.....|        :|       |||.:::|.
Mosquito   200 TLPSIVRLGEQSLVREDD-----GAEP-ENYDILRFIVHPDLKRSVGKY-------NDIALIQLT 251

  Fly   138 RRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYG 202
            .||.:.|.|||.|::.|    |.::..|...|...|.....|.|..||.:.::....|.|:|.|.
Mosquito   252 ERVIFTNFIRPACLYPS----EVLNVRTAIATGFGRTEYLGAKSDELRKVALNIYNNELCAERYR 312

  Fly   203 WN------MTFEQICAGNTL--SQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQ-CQNS-- 256
            ::      :...|:|.|:..  ...|..|||.|....:..|....|: ||:.|  .|| |.:|  
Mosquito   313 YDRHLRQGILSTQMCVGDLAGGKDTCQGDSGGPLQVTVQENHCMFYI-LGVTS--LGQVCGSSTP 374

  Fly   257 GILMDLLSYADWIKRVV 273
            .|...:..|.|||:.||
Mosquito   375 AIYTKVHPYLDWIESVV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 73/280 (26%)
Tryp_SPc 48..269 CDD:214473 71/277 (26%)
CLIPC3XP_313589.2 Tryp_SPc 146..390 CDD:238113 70/263 (27%)
Tryp_SPc 146..387 CDD:214473 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.