DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPC2

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_313588.3 Gene:CLIPC2 / 1274460 VectorBaseID:AGAP004317 Length:383 Species:Anopheles gambiae


Alignment Length:275 Identity:79/275 - (28%)
Similarity:110/275 - (40%) Gaps:59/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVNAKLAQNPWMAYLETPKG-----FHCSGTLINHLFVLTAAHCVPDDLLITVRL 88
            |....|:......|:..:.|.||.|..|..     |.|..|||:..:|:|||||: :...|.|||
Mosquito   123 CPTDQNLIVGGTAARFGEFPHMARLAMPDENGAMVFRCGATLISEQWVMTAAHCL-ESQTIVVRL 186

  Fly    89 GEYNTKTKVDCDNHLCQEPFQEYNVDMG----------FRHRYYNANDQTNDIGMLRLGRRVEYL 143
            ||                 .:|.|.:.|          .:|..|......|||.:|:|.|.|.:.
Mosquito   187 GE-----------------LKEGNDEFGDPVDVQVTRIVKHPNYKPRTVYNDIALLKLARPVTFS 234

  Fly   144 NHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFE 208
            ..|||.|::.|:...........|.:|    .|..|.||.|..:::|......||..:..|....
Mosquito   235 MRIRPACLYGSSTVDRTKAVAIGFGST----EAYGAASKELLKVSLDVFTTAACSVFFQRNRRVP 295

  Fly   209 Q------ICAGNTLS---QLCSTDSGAP-QIRKMWHNGSDRYVQ---LGIASRVKGQCQNS--GI 258
            |      :||| .||   ..|:.|||.| ||     :..|....   :||.|...| |.::  ||
Mosquito   296 QGLRESHLCAG-FLSGGRDTCTGDSGGPLQI-----SSEDEACVAQIIGITSFGIG-CGSTTPGI 353

  Fly   259 LMDLLSYADWIKRVV 273
            ...:..|.|||:.:|
Mosquito   354 YTRVSEYIDWIEGIV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 75/253 (30%)
Tryp_SPc 48..269 CDD:214473 73/250 (29%)
CLIPC2XP_313588.3 Tryp_SPc 130..367 CDD:238113 76/265 (29%)
Tryp_SPc 130..364 CDD:214473 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.