DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP003691

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_313476.4 Gene:AgaP_AGAP003691 / 1274366 VectorBaseID:AGAP003691 Length:831 Species:Anopheles gambiae


Alignment Length:244 Identity:59/244 - (24%)
Similarity:98/244 - (40%) Gaps:54/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ETPKGFHCSGTLINHLFVLTAAHCVPDDLL--ITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMG 116
            ||....||.|:||...||||||:|:....:  .|:.:|:||.           ..|.||.::.:.
Mosquito   275 ETGSKRHCYGSLIAPKFVLTAANCLRQYEVDGYTIEMGQYNV-----------YYPVQENSIRVR 328

  Fly   117 FR------HRYYNANDQTNDIGMLRLGRRVEYLNH-IRPICIFASNRFQEPIDQLTWFTTTVWRE 174
            ..      |..::|....||:.:|.:.:.:...|. :.|.||:..::.  |:|:........:.|
Mosquito   329 TEAKKIHYHPEFDAATLANDVALLEIVKPLYTFNKTVLPACIWPWDKL--PVDEYQTNGYVPFNE 391

  Fly   175 TAANA--TSKVLRTMNI-----DRQPKETCSEIYGWNMTFEQICAG--NTLS-QLCSTDSGAPQI 229
            :...:  |::...|.|:     |:.|:             .|.|||  ..|| :.|....|:...
Mosquito   392 SDDESVRTNQFFATANVYDECLDKVPQ-------------HQFCAGFPTALSPKSCHNSVGSAMS 443

  Fly   230 RKMWHNGSDRYVQLGIASRVKGQCQNSG-----ILMDLLSYADWIKRVV 273
            |.::..|  ||.....|...||  :|.|     :...:..|..||..:|
Mosquito   444 RSLYALG--RYFDYIFAINSKG--ENCGFNLPTVYTKIAPYVQWIDSIV 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/241 (24%)
Tryp_SPc 48..269 CDD:214473 56/238 (24%)
AgaP_AGAP003691XP_313476.4 Tryp_SPc 80..>152 CDD:304450
Tryp_SPc 276..484 CDD:214473 55/237 (23%)
Tryp_SPc 281..487 CDD:304450 56/235 (24%)
CLIP 506..554 CDD:197829
Tryp_SPc 600..820 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.