DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP003248

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_312959.4 Gene:AgaP_AGAP003248 / 1273921 VectorBaseID:AGAP003248 Length:296 Species:Anopheles gambiae


Alignment Length:281 Identity:76/281 - (27%)
Similarity:123/281 - (43%) Gaps:67/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISER---SVNAKLAQNPWMAYLE--TPKG---FHCSGTLINHLFVLTAAHCV---PDDL 82
            ||  ::..||   |:.|:|.:.||||.:|  .|.|   :.|.|:|||..:|:||||||   |...
Mosquito    40 CG--NDAPERLITSLVAQLDEAPWMALIEYWKPNGSLSYLCGGSLINERYVVTAAHCVTSLPQGW 102

  Fly    83 LI-TVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYN--ANDQTNDIGMLRLGRRVEYLN 144
            .: .:||||::..|..|||:..|.:...:..||....|..|.  :.:..|||.::||.|::.|..
Mosquito   103 TVHRIRLGEWDLSTSEDCDHSRCNDAPIDVAVDKITVHEDYKSPSRNHRNDIALIRLDRQMHYTE 167

  Fly   145 HIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFE- 208
            .:.|||:..:...|                      ::..|||:.....:|....|.|..:..| 
Mosquito   168 TVAPICLPQNGPLQ----------------------TQRYRTMHSVGWIEENFGPIGGKKLQVEQ 210

  Fly   209 -----QICAGNTL--------SQLCSTD--------SGAPQIRKMWHNGSDRYVQLGIAS---RV 249
                 |.|:.|.|        :|||...        :|.|.::::    :..:...|:||   |.
Mosquito   211 DLVDFQNCSSNYLQASIALADTQLCVAQQKDNRIDIAGGPLMQRI----AGHWYLFGVASFGGRN 271

  Fly   250 KGQCQNSGILMDLLSYADWIK 270
            .|..:...:..:::.|.|||:
Mosquito   272 YGTVELPNVYTNVMEYVDWIE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 69/259 (27%)
Tryp_SPc 48..269 CDD:214473 67/256 (26%)
AgaP_AGAP003248XP_312959.4 Tryp_SPc 53..291 CDD:214473 69/263 (26%)
Tryp_SPc 54..294 CDD:238113 71/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.