DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPB8

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_312743.1 Gene:CLIPB8 / 1273740 VectorBaseID:AGAP003057 Length:405 Species:Anopheles gambiae


Alignment Length:291 Identity:76/291 - (26%)
Similarity:133/291 - (45%) Gaps:63/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDCGIPHNISE--RSVNAKLAQNPWMAYLETPKGFH-----CSGTLINHLFVLTAAHCV------ 78
            :.|||...:::  ....|::.:.||||.|...:..:     |.|.||:..:|:||||||      
Mosquito   126 DSCGIQSYVAKIRGGQLAEIDEFPWMAMLLYERDNNALTQGCGGALISRTYVITAAHCVTGKNFQ 190

  Fly    79 -PDDLLITVRLGEYNTKTKVDC--DNHL--CQE-----------PFQEYNVDMGFRHRYYNANDQ 127
             ....|..|||.|||..|..||  :|.|  |.:           |..||:.:         :::|
Mosquito   191 QTKGRLKFVRLREYNIHTNPDCVYENDLKDCSDDMIDLVPQAVIPHPEYDSE---------SSNQ 246

  Fly   128 TNDIGMLRLGRRVEYLNHIRPICIFASNRFQE---PIDQLT---WFTTTVWRET-AANATSKVLR 185
            .:||.::|:.:...:.:.:|.||:...| |:.   |..:|:   |..|.::::. ..:..|.:..
Mosquito   247 QHDIALIRIEQTPPFTDFLRSICLPEQN-FESSATPGKKLSVSGWGRTDIFKDNLGPDVLSPIKL 310

  Fly   186 TMNIDRQPKETCSEIY-GWNMTF--EQICAGNTLSQ-LCSTDSGAPQI-----RKMWH-NGSDRY 240
            .:::....:|.||:.: .|:...  .|:|||...:: .|:.|||:|.:     |.:|: .|   .
Mosquito   311 KLSLPYVEREKCSKTFRPWSFALGPGQMCAGGERAKDTCAGDSGSPLMSYDMKRAIWYITG---I 372

  Fly   241 VQLGI-ASRVKGQCQNSGILMDLLSYADWIK 270
            |.||: ...|:|.   .|:..::..|..|||
Mosquito   373 VSLGVRGCGVEGL---PGVYTNVHHYLPWIK 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 72/268 (27%)
Tryp_SPc 48..269 CDD:214473 69/265 (26%)
CLIPB8XP_312743.1 CLIP 41..95 CDD:288855
Tryp_SPc 136..399 CDD:214473 70/278 (25%)
Tryp_SPc 139..400 CDD:238113 71/276 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.