DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPB10

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_312744.4 Gene:CLIPB10 / 1273735 VectorBaseID:AGAP003058 Length:362 Species:Anopheles gambiae


Alignment Length:285 Identity:85/285 - (29%)
Similarity:130/285 - (45%) Gaps:59/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGIPHNISERSVNAK---LAQNPWMAYLE--TPKG---FHCSGTLINHLFVLTAAHCVPD---- 80
            :||: ..:::|.:...   :.:.||.|.||  :.||   |.|.|:|||..:|||||||:.:    
Mosquito   100 ECGL-DTLADRIIGGNYTAIDEFPWYALLEYQSKKGERAFKCGGSLINGRYVLTAAHCLANKKLD 163

  Fly    81 --DLLITVRLGEYNTKTKVDC-----DNHLCQEPFQEYNVDMGFRHRYYNAND--QTNDIGMLRL 136
              :.|:.||||||||.|..||     |:  |.:|.|.:.::....|..|:.|.  |.:||.::||
Mosquito   164 EGERLVNVRLGEYNTATDTDCADGNPDD--CADPPQNFGIEAQIVHPGYDKNGPYQHHDIALIRL 226

  Fly   137 GRRVEYLNHIRPICIFASNRFQEPIDQL------TWFTTTVWRETAANATSKVLRTMNIDRQPKE 195
            .|.|...|.:.|:|:        |.|..      ...|...:..|.....|.:.:........:|
Mosquito   227 DRDVTMNNFVSPVCL--------PPDDFPPTSPGLNVTAVGFGHTGRQRHSGIKKKAQFPVFAQE 283

  Fly   196 TCS------EIYGWNMTFEQICAGNTLS-QLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC 253
            .|.      |:.|     ||:|||.... ..||.|||.|.:.|.::     ::|.|:.| ...||
Mosquito   284 ECDKKWKNIEVIG-----EQLCAGGVFGIDSCSGDSGGPLMVKRFY-----WIQEGVIS-FGNQC 337

  Fly   254 QNS---GILMDLLSYADWIKRVVRQ 275
            ...   |:...:.||.|||::.:|:
Mosquito   338 ALEGWPGVYTRVSSYLDWIRQNIRR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 81/257 (32%)
Tryp_SPc 48..269 CDD:214473 79/254 (31%)
CLIPB10XP_312744.4 CLIP 23..76 CDD:197829
Tryp_SPc 109..356 CDD:214473 80/267 (30%)
Tryp_SPc 110..359 CDD:238113 81/269 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.