DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPD1

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_312523.4 Gene:CLIPD1 / 1273538 VectorBaseID:AGAP002422 Length:435 Species:Anopheles gambiae


Alignment Length:259 Identity:72/259 - (27%)
Similarity:113/259 - (43%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEDCGIPHNISERSVNAKLAQN---PWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLIT-- 85
            |..||:......:....:.|.:   |||..|.:.:...|.|.||....||||||||. :|.:|  
Mosquito   190 ERGCGLSTKQLSKIAGGRPADSNEWPWMVALVSSRASFCGGVLITDRHVLTAAHCVM-NLKLTQF 253

  Fly    86 -VRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPI 149
             ||||||:.|       ...:..::::.|.....|..::.....|||.||:|.:...:.::|.||
Mosquito   254 VVRLGEYDFK-------QFNETRYRDFRVAEIRAHADFDQISYENDIAMLKLIQPSFFNSYIWPI 311

  Fly   150 CIFASNRFQEPIDQLTW----FTTTVW-RETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQ 209
            |:       .|:|. .|    ...|.| .:......|.||..:.|.....:.|.|:|...:....
Mosquito   312 CM-------PPLDD-AWTGYQAVVTGWGTQFFGGPHSPVLMEVRIPIWSNQECQEVYVNRIYNTT 368

  Fly   210 ICAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIAS-RVK-GQCQNSGILMDLLSYADWI 269
            :|||  :.....|..|||.|.:.::   .:.|:..:||.| .:: |:..:.||...:.||..||
Mosquito   369 LCAGEYDGGKDSCQGDSGGPLMIQL---PNRRWAVVGIVSWGIRCGEANHPGIYTRVSSYVRWI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 68/234 (29%)
Tryp_SPc 48..269 CDD:214473 66/232 (28%)
CLIPD1XP_312523.4 CLIP 102..147 CDD:197829
Tryp_SPc 202..429 CDD:214473 67/245 (27%)
Tryp_SPc 203..432 CDD:238113 69/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.