DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP002842

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_312070.5 Gene:AgaP_AGAP002842 / 1273118 VectorBaseID:AGAP002842 Length:282 Species:Anopheles gambiae


Alignment Length:235 Identity:65/235 - (27%)
Similarity:94/235 - (40%) Gaps:33/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNAN 125
            |.||||:..||||||||        ...|..:..|.|....|..:.|.....|.....|..|...
Mosquito    63 CGGTLISDRFVLTAAHC--------AHTGMSHPPTVVQLGAHDLRRPALYVGVRDVVLHPGYGGV 119

  Fly   126 DQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETA-ANATSKVLRTMNI 189
            ...|||.::||...|  .:.|:|..::.|....|.:..:    .|.|.:.. ....|.:|:.:.|
Mosquito   120 LAYNDIALIRLESPV--ASSIQPALLWRSETIPENVPLI----ATGWGKLGHFEDPSMILQRVQI 178

  Fly   190 DRQPKETCSEI--------YGWNMTFEQICAG--NTLSQLCSTDSGAPQIRKMWH----NGSDRY 240
            ...|...|:::        :|  :...|:|||  |.....|..|||.|...|:..    ..:.||
Mosquito   179 PIVPNSQCNQLLYRSRRLRHG--VLPSQLCAGDPNGGKDTCEGDSGGPLQLKLPSARPIGQAYRY 241

  Fly   241 VQLGIASR--VKGQCQNSGILMDLLSYADWIKRVVRQYGP 278
            ..:||.|.  :.|.....|:...:.|||.||.:|:.|..|
Mosquito   242 YVVGITSNGGICGTVDRPGLYTRVSSYAGWIDQVLEQITP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/227 (27%)
Tryp_SPc 48..269 CDD:214473 60/224 (27%)
AgaP_AGAP002842XP_312070.5 Tryp_SPc 26..275 CDD:238113 62/227 (27%)
Tryp_SPc 26..272 CDD:214473 60/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.