DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP010415

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_311533.3 Gene:AgaP_AGAP010415 / 1272633 VectorBaseID:AGAP010415 Length:304 Species:Anopheles gambiae


Alignment Length:174 Identity:47/174 - (27%)
Similarity:78/174 - (44%) Gaps:32/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QMLLEEDCGIPHNISERSVNAK--LAQNPWMAYLETP----KGFHCSGTLINHLFVLTAAHCVPD 80
            :::.:.:||...:|.|...:.|  ..|.|||..|..|    :...|:|.|:|..:||| .:||..
Mosquito   109 RLINQGNCGRNEHIYEFGEDRKPIFKQYPWMVTLRHPFVDSEYVPCNGVLLNRNYVLT-TNCVDL 172

  Fly    81 DLLITVRLGEYNTKTKVDC----DNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRL----- 136
            ...|:|.||:|:|....||    ....|....|..:|...||         .:::.:.||     
Mosquito   173 QDEISVTLGDYDTSKTKDCGTIDGREQCVSGVQTVSVGQLFR---------KDNLVLARLTVPAV 228

  Fly   137 -GRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANA 179
             |||    :||..||:..:.:.:|.:  ...:..|.|:|:.::|
Mosquito   229 IGRR----DHIESICLPVTPQQRERL--YNRYIMTGWKESGSDA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 41/146 (28%)
Tryp_SPc 48..269 CDD:214473 41/146 (28%)
AgaP_AGAP010415XP_311533.3 Tryp_SPc <1..92 CDD:304450
Tryp_SPc 135..>294 CDD:304450 42/148 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.