DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP010730

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_311444.4 Gene:AgaP_AGAP010730 / 1272531 VectorBaseID:AGAP010730 Length:256 Species:Anopheles gambiae


Alignment Length:260 Identity:69/260 - (26%)
Similarity:109/260 - (41%) Gaps:42/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AKLAQNPWMAYL------ETPKG-FHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDC 99
            ::.|:.||:.|:      |...| |.|.||||:...|:|.||.......:..|.||::..|..:.
Mosquito     3 SQYAEYPWVVYILALKKQEANSGDFVCGGTLIHSRLVVTTAHNTDGKTDLVARFGEWDISTTKEP 67

  Fly   100 DNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQL 164
            ....|..|.|:.:|....:|..|..|...|||.:|.|...|:|..||||||:      .:|.|:.
Mosquito    68 FPQQCLFPHQDIDVAEVIKHPQYVFNPIQNDIALLVLAENVQYAAHIRPICL------PQPTDEF 126

  Fly   165 TWFTTTVWRETAANATSK-------VLRTMNIDRQPKETCSEI-----YGWNMTFEQ--ICAGNT 215
                  |.:...:|...|       |::.:.:....:..|:.:     .|...|..:  :|||..
Mosquito   127 ------VGQRCVSNGWGKERGVYANVMKKLTLPVIGRANCTRMLRYAGLGPFYTLREGFLCAGGE 185

  Fly   216 LS-QLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC---QNSGILMDLLSYADWI-KRVVRQ 275
            :: .:|..|.|:|   ......|..||..||.|...| |   ...|:.:.:..|..|: :.:|.|
Mosquito   186 VAVDMCKGDGGSP---LACQTESGTYVLAGIVSWGIG-CGGFNTPGVYVAVNRYVQWLNEHIVDQ 246

  Fly   276  275
            Mosquito   247  246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/249 (27%)
Tryp_SPc 48..269 CDD:214473 65/245 (27%)
AgaP_AGAP010730XP_311444.4 Tryp_SPc 7..242 CDD:238113 66/250 (26%)
Tryp_SPc 7..238 CDD:214473 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.