DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPC10

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_310506.4 Gene:CLIPC10 / 1271650 VectorBaseID:AGAP000572 Length:380 Species:Anopheles gambiae


Alignment Length:326 Identity:82/326 - (25%)
Similarity:127/326 - (38%) Gaps:82/326 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NFIIGIAVICC---LWRRVQG---FQMLLEEDC-------GIPHNISERSVNAKLAQNPWMAYL- 53
            :|...:.::||   |..|:||   .:.:....|       |:..:|. ..|.|:..:.|:||.| 
Mosquito    78 SFNQSLPIVCCPVRLEPRLQGGTVAKRISVRQCEQFPNGTGLADHIF-NGVAAQFGEFPYMAALG 141

  Fly    54 -ETPKG--------FHCSGTLINHLFVLTAAHCVPDDLLITVRLG--EYNTKTKVDCDNHLCQEP 107
             ..|.|        |.|..:||:..|:||||||: .:..:..|||  |......||       ||
Mosquito   142 YGAPNGTEAGLPSLFRCGASLISSRFLLTAAHCL-RERPVFARLGVLELQPARTVD-------EP 198

  Fly   108 FQEYNVDMGFR----HRYYNANDQTNDIGMLRLGRRVE-YLNHIRPICIFASNRFQEPIDQLTWF 167
                 :|:..|    |..|:|....|||.:|.|...|. ....:.|:|:: :|.....::.|...
Mosquito   199 -----LDIAIRQATPHPDYHAVTYQNDIALLELAEPVTGDWPFVEPVCLY-TNATGGGLEALAGQ 257

  Fly   168 TTTV--WRETAANATSKVLRTM--NIDRQPKETCSEIY------------GWNMTFEQICA---- 212
            ..:|  |.......|....|.|  |:....::.|:...            |      |:||    
Mosquito   258 PLSVQGWGTQQPGDTEPAARLMKANVSLVERDACAASIPRTRRNPTGLHPG------QLCALGRN 316

  Fly   213 --GNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS---GILMDLLSYADWIKRV 272
              ..|::..|..|||.|    :..|...|:..:||.|  .|....|   ||..::..|.||::.:
Mosquito   317 EQNETVADTCPGDSGGP----LALNVDGRHYLVGITS--SGYSCGSPIPGIYTEVARYLDWVESI 375

  Fly   273 V 273
            |
Mosquito   376 V 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 69/265 (26%)
Tryp_SPc 48..269 CDD:214473 68/262 (26%)
CLIPC10XP_310506.4 CLIP 45..89 CDD:197829 2/10 (20%)
Tryp_SPc 122..372 CDD:214473 71/276 (26%)
Tryp_SPc 123..375 CDD:238113 72/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.