DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPC4

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_310504.4 Gene:CLIPC4 / 1271649 VectorBaseID:AGAP000573 Length:376 Species:Anopheles gambiae


Alignment Length:300 Identity:67/300 - (22%)
Similarity:114/300 - (38%) Gaps:57/300 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VICC--------------LWRRV--QGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYL----- 53
            |:||              ...|:  |..:........|..:||.|::.|...:.|::|.:     
Mosquito    93 VVCCPTEAPGTGDGTSNRFTARIAKQECERFTSASANIIDHISGRAIEALRGEFPFVALVNFRGE 157

  Fly    54 --ETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYN-TKTKVDCDNHLCQEPFQEYNVDM 115
              |..|...|..:||...|:||||||:.|...:||.:|... :.|:.|           ||.:..
Mosquito   158 EGEEVKLTRCGASLIAPRFLLTAAHCLKDLNPVTVEIGFIQLSDTEKD-----------EYEIKQ 211

  Fly   116 GFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANAT 180
            ...|..:.:  :.|||.::.|...|.|...:.|||:   |..:..|......|...|........
Mosquito   212 VHLHEGHKS--RRNDIALIELKNNVTYKQDVGPICL---NTDRPEIGPSINLTVMGWGADGDGQR 271

  Fly   181 SKVLRTMNIDRQPKETCSEIY-----GWNMTFEQICA-----GNTLSQLCSTDSGAPQIRKMWHN 235
            :..|....:...|.:.|.:.:     ..::..:|:||     .:..:..|..|||.|.:..:   
Mosquito   272 ADKLMKGTVYEIPLDECVQRFRDAKQRISLGEDQLCALGEKVNDETTDACQGDSGGPLVMTV--- 333

  Fly   236 GSDRYVQLGIASRVKGQCQNS--GILMDLLSYADWIKRVV 273
             ..::..:|:.| ....|..|  ||...:..|.:||::.|
Mosquito   334 -RQKFYLVGVVS-TGAVCGGSLPGIYTRVSRYLEWIEQRV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/243 (23%)
Tryp_SPc 48..269 CDD:214473 54/240 (23%)
CLIPC4XP_310504.4 Tryp_SPc 140..369 CDD:238113 57/249 (23%)
Tryp_SPc 140..367 CDD:214473 55/247 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.