DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP011325

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_309327.4 Gene:AgaP_AGAP011325 / 1270612 VectorBaseID:AGAP011325 Length:631 Species:Anopheles gambiae


Alignment Length:291 Identity:93/291 - (31%)
Similarity:147/291 - (50%) Gaps:35/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGI-----AVICCLW------RRVQGFQMLLEEDCGIPHNISER---SVNAKLAQNPWMAYL-ET 55
            :||     ..:||..      .|.:...:|..|.|| |: |.|:   .::|.|.|.||||.| :|
Mosquito   343 VGIEDEPRCAVCCQQEADSNNHRKRNLTLLDLEKCG-PY-IEEKIANGIDAILFQYPWMALLQDT 405

  Fly    56 PKGFHCSGTLINHLFVLTAAHCVPDDL-LITVRLGEYNTKTKVDCD--NHLCQEPFQEYNVDMGF 117
            ...|.|.|||||..:|||||||..:.| .|:|||||::.|:.:|||  ...|..|.|:..|:...
Mosquito   406 ELAFVCGGTLINKRYVLTAAHCFREKLSKISVRLGEFDLKSDIDCDKRGERCALPPQDIAVERTI 470

  Fly   118 RHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSK 182
            :|:.|:|..:.|||.::||.....|..::.|||:..|...: .:.::  :..:.|..|..:.:|.
Mosquito   471 KHKDYSARHKVNDIALIRLASEASYNENVMPICLPVSPEMR-TVKEI--YYVSGWGLTENDTSSD 532

  Fly   183 VLRTMNIDRQPKETCSEIYG-----WNMTFEQICA-GNTLSQLCSTDSGAPQIRKMWHNGSDRYV 241
            ||:...:.:.|.:.|.::..     ..:..:|:|| |...:..||.|||.| ::.:..|.  |:|
Mosquito   533 VLQVGLLRQLPNDVCQQLLQRKDKYVTVNSDQMCAIGANRTDNCSGDSGGP-LKTVAVNA--RFV 594

  Fly   242 QLGIAS---RVKGQCQNSGILMDLLSYADWI 269
            |.|:.|   |..|:....|:...:.:|.|||
Mosquito   595 QYGVVSYGLRTCGKETAPGVYTRVENYIDWI 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 78/235 (33%)
Tryp_SPc 48..269 CDD:214473 76/233 (33%)
AgaP_AGAP011325XP_309327.4 Tryp_SPc 44..287 CDD:238113
Tryp_SPc 46..286 CDD:214473
Tryp_SPc 384..625 CDD:214473 79/246 (32%)
Tryp_SPc 385..625 CDD:238113 79/245 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.