DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP005303

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_309096.4 Gene:AgaP_AGAP005303 / 1270372 VectorBaseID:AGAP005303 Length:371 Species:Anopheles gambiae


Alignment Length:266 Identity:56/266 - (21%)
Similarity:110/266 - (41%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ERSVNAKLAQNPW-MAYLETPK---GFHCSGTLINHLFVLTAAHCV--PDDLL----ITVRLGEY 91
            :..::||....|| :|......   |:.|.|::|:...:|||:|||  ...:|    ::|.:|..
Mosquito    43 QNGIDAKAGHWPWHVAIFHATSGRMGYACGGSIIDESTILTASHCVYTKSGVLSVSRVSVDVGRI 107

  Fly    92 NTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNR 156
            :..   :..|:.     |.:.|.....|..::.:...|||.:::|...:....:::|:|::..:.
Mosquito   108 HLN---ETSNYT-----QTHAVRQIIVHPRFSQHSIINDIALIKLRTNITMSKYVQPVCLWTMDS 164

  Fly   157 FQEPIDQLTWFTTTVWRE--------TAANATSKVLRTMNIDRQPKETC----SEIYGWNMTFEQ 209
            .|         |..|.|.        ...:..|..|:...:..|...||    .:::|.::|.:.
Mosquito   165 NQ---------TLIVGRSGTIVGFGLNERDVVSDQLKQALVGVQDGLTCIASDRDVFGTHLTTDM 220

  Fly   210 ICA-GNTLSQLCSTDSGAP---QIRKMWH-NGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWI 269
            .|. |...:..|:.|||..   ::...|: .|...:..|...::.....:|:. ..|:..|.|||
Mosquito   221 FCGMGQNGASACNGDSGGGMFFEVGGKWYVRGLVSFTPLNANTKPCDPRKNTA-YTDVAKYLDWI 284

  Fly   270 KRVVRQ 275
            |:.:.|
Mosquito   285 KQYIDQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 53/250 (21%)
Tryp_SPc 48..269 CDD:214473 50/247 (20%)
AgaP_AGAP005303XP_309096.4 Tryp_SPc 44..286 CDD:238113 54/259 (21%)
Tryp_SPc 44..284 CDD:214473 52/257 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.