DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPA10

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_308802.3 Gene:CLIPA10 / 1270130 VectorBaseID:AGAP006954 Length:1130 Species:Anopheles gambiae


Alignment Length:275 Identity:73/275 - (26%)
Similarity:121/275 - (44%) Gaps:46/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGI--PHNISERSVN-------AKLAQNPWMAYL--ETPKG--FHCSGTLINHLFVLTAAHCVP- 79
            ||:  ...|:.|..|       ::..:.||...:  :.||.  :.|.||||::|:::||||||. 
Mosquito   867 CGVRNAQGINGRIKNPVYVDGDSEFGEYPWQVAILKKDPKESVYVCGGTLIDNLYIITAAHCVKT 931

  Fly    80 -DDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYL 143
             :...:.|||||::....|:.      .|:.|.::.....|..|.|....||:.:|::.|.|:..
Mosquito   932 YNGFDLRVRLGEWDVNHDVEF------YPYIERDIISVQVHPEYYAGTLDNDLAILKMDRPVDLT 990

  Fly   144 N--HIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSK---VLRTMNIDRQPKETCSEI--- 200
            :  ||.|.|:  .::..:...|..|  ||.|.:.|.....|   :|:.:::.......|...   
Mosquito   991 SAPHIAPACL--PDKHTDFSGQRCW--TTGWGKDAFGDYGKYQNILKEVDVPIVNHYQCQNQLRQ 1051

  Fly   201 ----YGWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQL---GIASRVKGQCQNSG 257
                |.:|:....||||....: .|..|.|.|.:.:  .||..:.|.:   ||..   ||....|
Mosquito  1052 TRLGYTYNLNQGFICAGGEEGKDACKGDGGGPLVCE--RNGVWQVVGVVSWGIGC---GQANVPG 1111

  Fly   258 ILMDLLSYADWIKRV 272
            :.:.:..|.|||.:|
Mosquito  1112 VYVKVAHYLDWINQV 1126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 67/245 (27%)
Tryp_SPc 48..269 CDD:214473 65/242 (27%)
CLIPA10XP_308802.3 Tryp_SPc 888..1126 CDD:238113 67/252 (27%)
Tryp_SPc 888..1123 CDD:214473 65/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.