DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPB6

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_307757.4 Gene:CLIPB6 / 1269161 VectorBaseID:AGAP003252 Length:407 Species:Anopheles gambiae


Alignment Length:279 Identity:80/279 - (28%)
Similarity:130/279 - (46%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLEEDCGIPHNISERSV---NAKLAQNPWMAYLETPK-----GFHCSGTLINHLFVLTAAHCVPD 80
            ||.::||:.:  ::|.:   .|:|.:.||.|.::..:     .|||.|.||:..:|||||||:.:
Mosquito   136 LLPDECGVQY--TDRIIGGERAQLDEYPWTALIQHRRKNGELKFHCGGALISDRYVLTAAHCIEN 198

  Fly    81 D----LLITVRLGEYNTKTKVDCDN----HLCQEPFQEYNVDMGFRHRYYNANDQT--NDIGMLR 135
            .    .|..|||||::..:..||.|    .:|.:|.|:..::....|..|....|:  |||..:|
Mosquito   199 IQRSWTLTAVRLGEWDIDSDQDCANSYGERVCADPVQDIAIEKYIVHPGYAVQKQSVKNDIAQVR 263

  Fly   136 LGRRVEYLNHIRPICIFASNRFQEPID--QLT------WFTTTVWRETAANATSKVLRTMNIDRQ 192
            |.|...:.::::|||:        |::  |.|      .|....|.:|.....|:....:.:...
Mosquito   264 LARPAVFNDYVQPICL--------PLEPAQRTISYDGQRFVVAGWGQTEDAPRSRYKLYVGVSGV 320

  Fly   193 PKETCSEIY---GWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC 253
            |::||.:.|   |.:.|  |:|||.|..| .|..|||.| :..:....|:..:.||.......||
Mosquito   321 PEQTCQQQYPQAGIDRT--QVCAGGTAKQDSCRGDSGGP-LMYVGQRNSEGVMYLGGLVSYGRQC 382

  Fly   254 QNS---GILMDLLSYADWI 269
            ...   |:...:..:.|||
Mosquito   383 GLEGVPGVYTRVNQFVDWI 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 73/252 (29%)
Tryp_SPc 48..269 CDD:214473 71/250 (28%)
CLIPB6XP_307757.4 CLIP 45..97 CDD:288855
Tryp_SPc 148..401 CDD:214473 74/263 (28%)
Tryp_SPc 149..404 CDD:238113 75/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.