DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CLIPB4

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_307755.1 Gene:CLIPB4 / 1269159 VectorBaseID:AGAP003250 Length:360 Species:Anopheles gambiae


Alignment Length:284 Identity:82/284 - (28%)
Similarity:138/284 - (48%) Gaps:30/284 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VICCLWRRVQGFQMLLEE-DCGIPHNISERSVN---AKLAQNPWMAYLETPK-----GFHCSGTL 65
            ::||...|.:|...|.|. :||:  .:::|.:.   .|:.:.||.|.:|..|     ||||.|::
Mosquito    80 LVCCAGVRSKGKTSLPESPNCGV--QLTDRVIGGQPTKIDEFPWTALIEYEKPNGRFGFHCGGSV 142

  Fly    66 INHLFVLTAAHC---VPDDLLI-TVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNAND 126
            ||..::||||||   :|....: .|||||::..:..|.::....:...:.:::....|..||..|
Mosquito   143 INERYILTAAHCITSIPRGWKVHRVRLGEWDLSSTTDQEDDFYADAPIDLDIEKIIVHPGYNLQD 207

  Fly   127 QT--NDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRET-AANATSKVLRTMN 188
            ::  |||.::|..|.:.|.:.|..||:..||..:.............|.:| .|:|:.|.|: :.
Mosquito   208 KSHHNDIALIRFNREINYSSTISAICLPLSNSLRNRKHAGLSSYAAGWGKTETASASQKKLK-VE 271

  Fly   189 IDRQPKETCSEIY---GWNMTFEQICAGNTLSQ-LCSTDSGAPQIRKMWHNGSDRYVQLGIASRV 249
            :.....:.||..|   |.::...|:|||....: .||.|||.|.:|:|    |..:..:|:.|..
Mosquito   272 LTVVDVKDCSPAYQRNGISLDSTQMCAGGIRGKDTCSGDSGGPLMRQM----SGSWYLIGVVSFG 332

  Fly   250 KGQCQN---SGILMDLLSYADWIK 270
            ..:|..   .|:..::..|.||||
Mosquito   333 PQKCGAPGVPGVYTNVAEYVDWIK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 72/242 (30%)
Tryp_SPc 48..269 CDD:214473 69/239 (29%)
CLIPB4XP_307755.1 CLIP 31..83 CDD:371857 0/2 (0%)
Tryp_SPc 108..358 CDD:238113 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.