DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Gzmbl3

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001316809.1 Gene:Gzmbl3 / 120766154 RGDID:2320502 Length:248 Species:Rattus norvegicus


Alignment Length:244 Identity:65/244 - (26%)
Similarity:97/244 - (39%) Gaps:33/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AKLAQNPWMAYL----ETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNH 102
            ||....|:||||    |......|.|.||...||||||||:...  |||.||.:|.|.       
  Rat    27 AKPHSRPYMAYLQIMDEDSGSTMCGGFLIQEDFVLTAAHCLGSK--ITVTLGAHNIKE------- 82

  Fly   103 LCQEPFQE-YNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTW 166
              ||..|: ..|.....|..||:...:|||.:|:|..:.:....::.:.:..||...:|.|..  
  Rat    83 --QEKMQQVIPVVKIIPHPAYNSKKYSNDIMLLKLKSKAKRTRAVKTLSLPRSNFKVKPGDVC-- 143

  Fly   167 FTTTVWRETA-ANATSKVLRTMNIDRQPKETCSEIY--GWNMTFEQICAGNTLSQLCS--TDSGA 226
             ....|.:.. .......|:.:.:..|..:.|...:  .:|.. .|||||:...:..|  .|||.
  Rat   144 -NVAGWGKLGPMGKFPDKLQEVELTVQEDQECETYFKKAYNKA-NQICAGDPKIKRASFGGDSGG 206

  Fly   227 PQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRVVRQ 275
            |.:.|.        |..||.:..............:.::..|||..:::
  Rat   207 PLVCKK--------VAAGIVAYGSKNGSAPEAFTKVSTFLSWIKETMKK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 63/233 (27%)
Tryp_SPc 48..269 CDD:214473 60/230 (26%)
Gzmbl3NP_001316809.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.