DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and LOC116408674

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_031752209.1 Gene:LOC116408674 / 116408674 -ID:- Length:392 Species:Xenopus tropicalis


Alignment Length:242 Identity:59/242 - (24%)
Similarity:106/242 - (43%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKT-KVDCDNHLCQEP---FQEYNVDMGFRHRY 121
            |:||::|:.::.|||||      .....||.:.|: :|....||..|.   .|..||....:|..
 Frog     8 CTGTVLNNQWIFTAAHC------FRHLNGENDIKSLQVVLGAHLLSEKEKHIQVLNVKQIIQHEL 66

  Fly   122 YNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQ---LTWFTTTVWRETAANATSKV 183
            |:...|..||.:::|.:.|:..::::|.|:..|:...||:.:   ..|.......|..|     :
 Frog    67 YDPKVQYYDIALIQLNKPVQLNDYVQPACLPMSSATLEPLTECYLAGWGVRDEGDEPVA-----I 126

  Fly   184 LRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLS-QLCSTDSGAPQIRKMWHNGSDRYVQLGIAS 247
            ::.:.::|...:.|::.|...:....:||....: :.|..||.||.:.|  ...|..:..:||||
 Frog   127 MQEVKVERINSKRCNKTYLGAIQEYHLCASQKANMKSCQGDSAAPLMCK--RKTSTIFSVIGIAS 189

  Fly   248 RVKG--QCQNSGILMDLLSYADWI--KRVVRQYGPSTDMNRSLKKWV 290
            ...|  |..:.||......:..|:  |....:....|.:..|:.|.:
 Frog   190 WGSGCSQINSPGIYTSTKDFVKWMVEKVTSEEIKSKTKVKESVLKMI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 56/222 (25%)
Tryp_SPc 48..269 CDD:214473 54/217 (25%)
LOC116408674XP_031752209.1 Tryp_SPc 2..212 CDD:238113 54/216 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.