DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and AgaP_AGAP013252

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_003436670.1 Gene:AgaP_AGAP013252 / 11175997 VectorBaseID:AGAP013252 Length:597 Species:Anopheles gambiae


Alignment Length:336 Identity:79/336 - (23%)
Similarity:134/336 - (39%) Gaps:73/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNFIIGIAVICCLW--RRVQGFQMLLEEDCGIPHNISERSVNA-KLAQN---------PWMAYL 53
            :..|:..|||.|.:.  |:......       :|....||.|.. .|.|:         ||...:
Mosquito     5 LRGFLALIAVFCAIGEVRKTNALDT-------VPLECGERKVKTIYLVQHGTETKEGHWPWHTAI 62

  Fly    54 ----ETPKGFHCSGTLINHLFVLTAAHCV--------PDDLLITV---RLGEYNTKTKVDCDNHL 103
                :|...:.|.|::::...:||||||:        .|.|.:.|   :|.|.:.::        
Mosquito    63 YHREQTNFEYVCGGSILDRNTILTAAHCLYTSRGLIKLDQLSVQVGRNQLSEASVRS-------- 119

  Fly   104 CQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEP-IDQLTWF 167
                 ||::.:....|..::.|..|:||.:::|...:....:::|:|:::    .|| :|.:...
Mosquito   120 -----QEHHPEQLIVHPGFSPNSVTDDIALIKLATDITMTRYVQPVCLWS----LEPNLDLIVGR 175

  Fly   168 TTTV--WRETAANATSKVLRTMNIDRQPKETCSE----IYGWNMTFEQIC-AGNTLSQLCSTDSG 225
            ..||  :..|..:..|..||...|......||.|    :||..:|....| .|.|...:|:.|||
Mosquito   176 NGTVVGFGLTEHDRVSDYLRQAAIAVVDSWTCIESDRQVYGVTLTANMYCGGGKTGVSVCNGDSG 240

  Fly   226 APQIRKMWHNGSDRYVQLGIASRVK-----GQCQNS--GILMDLLSYADWIKRVVRQYGPSTDMN 283
            ...   .:.:|...||: |:.|.:.     |.|..:  .:..|:..|.|||.:.|   .|:....
Mosquito   241 GGM---FFEHGDTWYVR-GVVSFMPLRENVGLCDGTKYTVFTDVAKYRDWIGQNV---NPTLAST 298

  Fly   284 RSLKKWVDKIP 294
            |.....||..|
Mosquito   299 RPDPLLVDNSP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/253 (24%)
Tryp_SPc 48..269 CDD:214473 59/250 (24%)
AgaP_AGAP013252XP_003436670.1 Tryp_SPc 47..287 CDD:214473 59/260 (23%)
Tryp_SPc 48..287 CDD:238113 59/259 (23%)
Tryp_SPc 334..575 CDD:214473
Tryp_SPc 335..575 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.