DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and F11

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_082342.1 Gene:F11 / 109821 MGIID:99481 Length:624 Species:Mus musculus


Alignment Length:277 Identity:68/277 - (24%)
Similarity:105/277 - (37%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VQGFQMLLEEDCGIPHNISERSVNAKL--------AQNPWMAYLETPKGFHCSGTLINHLFVLTA 74
            :.|:.:.|   |.: .|:....:|.::        .:.||...|...:|..|.|::|.:.::|||
Mouse   368 ISGYSLRL---CKM-DNVCTTKINPRVVGGAASVHGEWPWQVTLHISQGHLCGGSIIGNQWILTA 428

  Fly    75 AHC-----VPDDLLI---TVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDI 131
            |||     .|..|.:   .|...|.|..|..             :.|.....|..|...:...||
Mouse   429 AHCFSGIETPKKLRVYGGIVNQSEINEGTAF-------------FRVQEMIIHDQYTTAESGYDI 480

  Fly   132 GMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANA-TSKVLRTMNIDRQPKE 195
            .:|:|...:.|.:..||||: .|...:..:....|  .|.|..||... ....|:...:.....|
Mouse   481 ALLKLESAMNYTDFQRPICL-PSKGDRNAVHTECW--VTGWGYTALRGEVQSTLQKAKVPLVSNE 542

  Fly   196 TCSEIY-GWNMTFEQICAG--NTLSQLCSTDSGAP---QIRKMWHNGSDRYVQLGIASRVK--GQ 252
            .|...| ...:|.:.||||  ......|..|||.|   :...:||       .:||.|..:  ||
Mouse   543 ECQTRYRRHKITNKMICAGYKEGGKDTCKGDSGGPLSCKYNGVWH-------LVGITSWGEGCGQ 600

  Fly   253 CQNSGILMDLLSYADWI 269
            .:..|:..::..|.|||
Mouse   601 KERPGVYTNVAKYVDWI 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 63/239 (26%)
Tryp_SPc 48..269 CDD:214473 61/237 (26%)
F11NP_082342.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..376 CDD:128519 2/10 (20%)
Tryp_SPc 389..617 CDD:214473 61/250 (24%)
Tryp_SPc 390..617 CDD:238113 61/249 (24%)
Heparin-binding. /evidence=ECO:0000250 547..550 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.