DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and LOC108648818

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_017952796.2 Gene:LOC108648818 / 108648818 -ID:- Length:928 Species:Xenopus tropicalis


Alignment Length:257 Identity:67/257 - (26%)
Similarity:111/257 - (43%) Gaps:38/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GIPHNISERSV---NAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCV--PDDLLITVRLG 89
            |.|..:.::.|   ||.|...||.|.|.:  .:.|..:||::.:::|||||:  .|....|||||
 Frog   689 GGPSALEDKIVGGTNAVLGSWPWQAALVS--NYLCGASLISNTWLVTAAHCIVTNDPNSYTVRLG 751

  Fly    90 E---YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICI 151
            .   |:|              ...:.:.....|..|.:.....||.:|:|...|.:.::|:.:|:
 Frog   752 TLYWYST--------------INRFKLQQIIIHENYTSATMGYDIALLKLATPVTFTSYIQSVCL 802

  Fly   152 -FASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSE--IYGWNMTFEQICAG 213
             .||:.|.   |..:.:.|.....:...:.|.:|:...::....:.||.  :||..:....:|||
 Frog   803 PEASSSFP---DNSSCYITGWGTLSYGGSVSNILQEAQVEIISTKLCSSSLMYGSTIKPSMLCAG 864

  Fly   214 --NTLSQLCSTDSGAPQIRKMWHNGSD-RYVQLGIASRVKG--QCQNSGILMDLLSYADWIK 270
              |.....|..|||.|.:   :.|.|| .:..:||.|...|  |....|:...:....:|||
 Frog   865 YVNGNIDSCQGDSGGPLV---YRNSSDSSWYLVGIISFGDGCAQAYRPGVYARVTYLRNWIK 923

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/236 (26%)
Tryp_SPc 48..269 CDD:214473 58/233 (25%)
LOC108648818XP_017952796.2 Tryp_SPc 698..925 CDD:238113 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.