DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and LOC108647852

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:299 Identity:69/299 - (23%)
Similarity:125/299 - (41%) Gaps:67/299 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGI-----PHNISERSVNAKLAQN---PWMAYLE----TPKGFHCSGTLINHLFVLTAAHCVPD- 80
            |||     .|:...|.:.....:.   ||||.::    ...|..|.|.|:::.:|:|||||:.| 
 Frog    29 CGIRPLVKNHHRVRRVIEGNTPEPGSWPWMASIQLLYKDGYGSACGGVLLSNRWVVTAAHCLSDL 93

  Fly    81 -------DLLITVR-LGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLG 137
                   .:::..| |.:...:|::             ..:....:|..::.....|||.::||.
 Frog    94 KRYRHLARIVLGARDLTQLGPETQI-------------RTIKQWIQHEDFDHKTHKNDIALIRLN 145

  Fly   138 RRVEYLNHIRPICI--FASNRFQEP---------IDQLTWFTTTVWRETAANATSKVLRTMNIDR 191
            ..|::.::|:|.|:  .:||.::..         :::.....||:.:|    ||.::     |||
 Frog   146 YPVKFSDYIQPACLPPKSSNVYKMDDCHIAGWGLLNEKPRTVTTMLQE----ATVEL-----IDR 201

  Fly   192 QPKETCSEIYGWNMTFEQICAGNTLS--QLCSTDSGAPQIRKMWHNGSDRYVQLGIAS--RVKGQ 252
            : :...|:.|...:..:.:|||....  .:|..|||.|.:.|....|.  |..:||.|  .:.||
 Frog   202 K-RCNSSDWYNGGIHDDNLCAGYEQGGPDVCMGDSGGPLMCKRKKAGI--YYVVGIVSWGGLCGQ 263

  Fly   253 CQNSGILMDLLSYADWIKRVVRQYGP------STDMNRS 285
            ..::|:...:..:..||........|      :|.||.|
 Frog   264 PHSNGVYTSVQDFEQWIFNKTSSSNPKYHYMRATSMNIS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 59/251 (24%)
Tryp_SPc 48..269 CDD:214473 57/248 (23%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 57/260 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.