DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:258 Identity:83/258 - (32%)
Similarity:118/258 - (45%) Gaps:34/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CG-IPHNISERSV---NAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCV---PDDLLITV 86
            || ||.|.|..:|   |:.....||.|.|....|..|.|:|||..:||:||||.   .:...:||
Zfish   297 CGIIPVNSSNGTVGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFNGQRNGFYLTV 361

  Fly    87 RLGEYNTKTKVDCDNHLCQEPFQ-EYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPIC 150
            .||. .|:.|.|        |.: ..:|....:|.|||.|...|||.::||...:.:.:.|||:|
Zfish   362 ILGP-KTQNKYD--------PSRISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVC 417

  Fly   151 IFASNR-FQEPIDQLTWFTTTVWRETAANA---TSKVLRTMNIDRQPKETCSEIYG-WNMTFEQI 210
            :.|... |..  |..:|.||  ||..:...   :.|:.:.:.:.......|:.:|| .::|...|
Zfish   418 LAAEGSVFNS--DTESWITT--WRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMI 478

  Fly   211 CAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS--GILMDLLSYADWI 269
            |||  .....||..|||.|.:    .|.|..:||.||.|...|..|:.  |:...:..|.:||
Zfish   479 CAGLLKEGKDLCQGDSGGPMV----SNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 75/235 (32%)
Tryp_SPc 48..269 CDD:214473 73/233 (31%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 75/244 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.