DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG42694

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:291 Identity:83/291 - (28%)
Similarity:130/291 - (44%) Gaps:63/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEEDCGIPHNISERSVNAKLAQNP--WMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVR 87
            |::.||.|  ||.:|: .||.|..  |:|::.......|||:||:..|||:||.|:.....:.|:
  Fly    23 LDDYCGAP--ISNQSI-TKLRQPQAGWLAHISNGTHVLCSGSLISKQFVLSAAQCIDVHGKLFVQ 84

  Fly    88 LGEYN-TKTKVDCDNHLCQEPFQEYNVDMGFRHRY---------YNANDQTNDIGMLRLGRRVEY 142
            ||..| ||:.                      |.|         ::......|||:|:|.:.|:|
  Fly    85 LGVSNATKSP----------------------HWYTVSNVVIPSHSGKRLQRDIGLLKLSQSVDY 127

  Fly   143 LNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTF 207
            .:.:.||||..:....:.:..|..|||:.|.....|..:.||..::.||     |......|:|.
  Fly   128 NDFVYPICIALNTNTLDMVKILQNFTTSAWLSKNKNPQTIVLSQLSRDR-----CKLNLSGNVTP 187

  Fly   208 EQICAGN-TLSQLCSTDSGA----PQIRKMWHNGSD--RYVQLGIASRVKGQ--CQNSGILMDLL 263
            ::|||.: ..:..|..|||:    |.|:     ||:  |.:..||...|.|:  |....|.:|:.
  Fly   188 KEICAASLQRNNSCFIDSGSALTQPIIQ-----GSNIVREMLFGIRGYVNGRSWCSEPAIYIDVA 247

  Fly   264 SYADWIKRVVRQYG-------PSTDMNRSLK 287
            ....||:.||:||.       .:.::|:.||
  Fly   248 ECVGWIETVVQQYDGTDSRAVATPEVNQHLK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/244 (27%)
Tryp_SPc 48..269 CDD:214473 64/241 (27%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 66/241 (27%)
Tryp_SPc 46..253 CDD:214473 64/238 (27%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.