DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:272 Identity:66/272 - (24%)
Similarity:113/272 - (41%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVN---AKLAQNPWMAYLETPKG---FHCSGTLINHLFVLTAAHCVPDDLLITVR 87
            ||:...:..|.|.   |.:...||...|....|   :.|.|::|...:::||||||         
 Frog   255 CGLSTKVDSRIVGGTPASVGDWPWQVELLKLVGTSIYLCGGSIITPHWIVTAAHCV--------- 310

  Fly    88 LGEYNTKT--KVDCDNHLCQEPFQE-YNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPI 149
            .|..:|.:  ||...:...|..:.. |.|:....|..|::..|..|:.:|:|...:.:..::||:
 Frog   311 YGSTSTPSAFKVFAGSLTIQSYYSAGYTVERALVHPSYSSYTQIYDVALLKLTAALVFTTNLRPV 375

  Fly   150 CI------FASNRFQEPIDQLTWFTTTVWRETA-ANATSKVLRTMNIDRQPKETCSE--IYGWNM 205
            |:      :|..       |..|.:.  |..|| ..:.||.|...::......||::  :||..:
 Frog   376 CLPNVGMPWAEG-------QPCWISG--WGTTAEGGSISKNLMAASVPIISSTTCNQAAVYGGAI 431

  Fly   206 TFEQICAG--NTLSQLCSTDSGAPQIRK---MWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSY 265
            :...:|||  :..:..|..|||.|.:.|   :|....|.....|.|...|     .|:..::..:
 Frog   432 SSTMMCAGYLSGGTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCARAYK-----PGVYGNVTVF 491

  Fly   266 ADWIKRVVRQYG 277
            .:||...::.||
 Frog   492 IEWIYSQMQTYG 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 59/243 (24%)
Tryp_SPc 48..269 CDD:214473 57/240 (24%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 2/3 (67%)
Tryp_SPc 265..498 CDD:238113 61/255 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.