DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and LOC101732176

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:278 Identity:67/278 - (24%)
Similarity:110/278 - (39%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGIPHNISERSVNAKLA---QNPWMAYLETPKG---FHCSGTLINHLFVLTAAHCV------PD 80
            :||:...:..|.|....|   ..||...|....|   :.|.|::|...:::||||||      |.
 Frog   266 NCGLSTKVDNRIVGGTFALAGDWPWQISLMKLVGTSLYLCGGSIITPYWIVTAAHCVYGYTSSPS 330

  Fly    81 DLLI---TVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEY 142
            ...:   ::.|..|.:               ..|.||....|..|:.|.|..||.:|:|...:.:
 Frog   331 IFKVFAGSLTLSNYYS---------------AGYLVDRVLIHPSYSPNTQNYDIALLKLKTALVF 380

  Fly   143 LNHIRPICI------FASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETC--SE 199
            ..::||:|:      :|..   :|.....|.||     :.|.:.|..|:..::......||  :.
 Frog   381 STNLRPVCLPNVGMPWADG---QPCWISGWGTT-----SEAGSISTSLKAASVPIISSATCNLAP 437

  Fly   200 IYGWNMTFEQICAG--NTLSQLCSTDSGAPQIRK---MWHNGSDRYVQLGIASRVKGQCQNSGIL 259
            :||..::...||||  ...:..|..|||.|.:.|   :|....|.....|.|...|     .|:.
 Frog   438 VYGGVISPTMICAGYLGGGTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCARAYK-----PGVY 497

  Fly   260 MDLLSYADWIKRVVRQYG 277
            .::..:.:||...::.||
 Frog   498 GNITVFLEWIYSQMQTYG 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 60/248 (24%)
Tryp_SPc 48..269 CDD:214473 58/245 (24%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 2/4 (50%)
Tryp_SPc 277..510 CDD:238113 62/260 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.