DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and si:ch73-182e20.4

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_009296334.2 Gene:si:ch73-182e20.4 / 100535157 ZFINID:ZDB-GENE-131127-155 Length:341 Species:Danio rerio


Alignment Length:284 Identity:73/284 - (25%)
Similarity:113/284 - (39%) Gaps:69/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPH-NISERSV---NAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCV---PDDLLITV 86
            ||.|: .::.|.|   |:.....|||..|.......|.|:|||:.:||||||||   ..::|  |
Zfish    60 CGRPNPQLNPRIVGGLNSTEGAWPWMVSLRYYGNHICGGSLINNEWVLTAAHCVNLTRSNML--V 122

  Fly    87 RLGEYNTKTKVDCDNHLCQEPFQEYNVDMG---------FRHRYYNANDQTNDIGMLRLGRRVEY 142
            .||::                 :.|..|:.         ..|..||:....|||.:|:|...|.|
Zfish   123 YLGKW-----------------RRYAADVNEITRTVSNIIPHPSYNSTTYDNDIALLQLSSTVHY 170

  Fly   143 LNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKV--LRTMNIDRQP----KETCSEIY 201
            .::|:|:|: |..:...|....:|  .|.|.....:....:  ..|:::...|    :|...::|
Zfish   171 SDYIKPVCL-ADEQSNFPPGTRSW--ATGWGRIGVSGKGGIRGRTTVSVPLPPPGILQEVKLKVY 232

  Fly   202 GWNMTFEQICAGN-TLSQLC-----------STDSGAPQIRK---MWHNGSDRYVQLGIASRVKG 251
            . |.....||.|. ..:.:|           |.|||.|.:.|   :|       ||.|:.|...|
Zfish   233 S-NADCNSICHGRINPNMICAGTRSGGKATFSGDSGGPLVSKQCSVW-------VQAGVVSHGYG 289

  Fly   252 QCQNS--GILMDLLSYADWIKRVV 273
            ..|.:  .:.:.:..|..||...|
Zfish   290 CAQPNLPEVFIRVSEYKQWITAAV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/258 (26%)
Tryp_SPc 48..269 CDD:214473 64/255 (25%)
si:ch73-182e20.4XP_009296334.2 Tryp_SPc 71..309 CDD:238113 66/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.