DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and tmprss2.12

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_031752400.1 Gene:tmprss2.12 / 100497514 XenbaseID:XB-GENE-22065925 Length:497 Species:Xenopus tropicalis


Alignment Length:279 Identity:65/279 - (23%)
Similarity:109/279 - (39%) Gaps:62/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGIPHNISERSV---NAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDL----LIT 85
            |||:......|.|   :|.:...||...|:......|.|::|...:::||||||..|.    |..
 Frog   250 DCGLSTYGESRIVGGSSASIGDWPWQVNLQYDDTNLCGGSVIAANWIVTAAHCVQGDTSSPSLWK 314

  Fly    86 VRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPIC 150
            ..:|:....:..|.         ..|:||....|..|::...:|||.:::|...:.:.:..||:|
 Frog   315 AFIGKIKMPSYYDS---------SAYSVDRIIVHPDYSSQTNSNDIALMKLKTSIAFSSISRPVC 370

  Fly   151 IFASN---RFQE--PIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSE--IYGWNMTFE 208
            :  .|   :::|  |.....|.||     :...:.|.||:...:......||::  :|...:|..
 Frog   371 L--PNYGMQWEEGQPCYISGWGTT-----SQKGSISSVLKYAMVPLISPTTCNQTIMYNGAITSS 428

  Fly   209 QICAGNTLSQL--CSTDSGAPQIRK-----------MWHNGSDRYVQLGIASRVKGQCQN---SG 257
            .||||.....:  |..|||.|.:.|           .|.:|                |.|   .|
 Frog   429 MICAGYPKGGVDSCQGDSGGPLVTKTNSLWWLVGDTSWGDG----------------CANVYRPG 477

  Fly   258 ILMDLLSYADWIKRVVRQY 276
            :..::..:..||...::.|
 Frog   478 VYGNMTVFLQWIYLQMQMY 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/250 (23%)
Tryp_SPc 48..269 CDD:214473 56/247 (23%)
tmprss2.12XP_031752400.1 LDLa 127..155 CDD:238060
SRCR_2 160..255 CDD:406055 3/4 (75%)
Tryp_SPc 261..489 CDD:238113 58/259 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.