DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and LOC100497505

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_002940490.1 Gene:LOC100497505 / 100497505 -ID:- Length:308 Species:Xenopus tropicalis


Alignment Length:276 Identity:68/276 - (24%)
Similarity:105/276 - (38%) Gaps:47/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGI---PHNISERSVNAKLAQN---PWMAYLET-PKG----FH-CSGTLINHLFVLTAAHC--- 77
            |||:   ..|.:.|.|:....:.   ||...|:. |:|    .| |.||||:..::||||||   
 Frog    37 DCGVSFFQQNTAGRIVSGNEVRPYSWPWQVSLQVRPRGGKKYVHVCGGTLIHKSWILTAAHCFQK 101

  Fly    78 --VPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHR---YYNANDQTNDIGMLRLG 137
              ..|.....:.:|::|.        :..:...:.|:|...:||.   |...||...||.:::..
 Frog   102 GKAEDAANWRIVVGKHNL--------NRTEATEKVYSVKRIYRHERFSYPQLNDLDYDIALVKPA 158

  Fly   138 RRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRET---AANAT-SKVLRTMNIDRQPKETC- 197
            ..:...:.|...|:........| ....|  .|.|.:|   ..|.| |:||....:.....:|| 
 Frog   159 EDIITTHFIHYACLPKKEMAMHP-GHFCW--VTGWGDTRGGQGNVTLSEVLNQARLPIIDTKTCR 220

  Fly   198 -SEIYGWNMTFEQICAG----NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC---Q 254
             .:.:|..:....||||    ......|..|||.|.:   ..:|..|:...||.|.....|   .
 Frog   221 HKKFWGDRIRESMICAGFRNVGGPPAACQGDSGGPLV---CQDGRGRWEVHGIVSFGPVGCTVEN 282

  Fly   255 NSGILMDLLSYADWIK 270
            ...:.....:|..||:
 Frog   283 KPSVFTKTSTYIPWIE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/250 (25%)
Tryp_SPc 48..269 CDD:214473 60/247 (24%)
LOC100497505XP_002940490.1 Tryp_SPc 51..300 CDD:238113 63/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.