DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and tmprss13

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_002932950.2 Gene:tmprss13 / 100491822 XenbaseID:XB-GENE-940757 Length:462 Species:Xenopus tropicalis


Alignment Length:270 Identity:60/270 - (22%)
Similarity:109/270 - (40%) Gaps:50/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DCGIPHNISER---SVNAKLAQNPWMAYLETPKGFH----CSGTLINHLFVLTAAHCVPDDLLIT 85
            |||  ..::.|   .|:|||...||...|....|..    |.||:||:.:|.||.||..:    |
 Frog   213 DCG--KRMANRIIGGVSAKLGDYPWQVSLHQRAGNRFAHVCGGTIINNKWVATATHCFQE----T 271

  Fly    86 VRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPIC 150
            |....:.....:...::|    ...:.|.:..|:..||::....|:.::::.:...:...|:|.|
 Frog   272 VDPANWRVYAGIINQHNL----NAMHTVTVIVRNENYNSDTDDFDMALMKMKQPFIFTAAIQPAC 332

  Fly   151 I--FASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSE--IYGWNMTFEQIC 211
            :  ...|..|..|..::.|..|:   .:::..|:.|....:...|...|::  :|...:|...:|
 Frog   333 LPMMNQNFGQNDICFISGFGKTI---QSSDEGSQYLMQAQVHVIPTSVCNKVNVYNGAITPRMMC 394

  Fly   212 AGNTLSQL--CSTDSGAPQIRKM-----------WHNGSDRYVQLGIASRVKGQCQNSGILMDLL 263
            ||....|:  |..|||.|.:.:.           |.:|.             ||....|:..::.
 Frog   395 AGYLQGQIDSCQGDSGGPLVCQQGGIWYLAGVTSWGSGC-------------GQANKPGVYSNVN 446

  Fly   264 SYADWIKRVV 273
            ::..||.:.:
 Frog   447 AFLQWIYKQI 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 52/244 (21%)
Tryp_SPc 48..269 CDD:214473 50/241 (21%)
tmprss13XP_002932950.2 SRCR_2 128..217 CDD:382996 3/5 (60%)
Tryp_SPc 222..455 CDD:238113 56/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.