DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and tmprss3

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_031752328.1 Gene:tmprss3 / 100490444 XenbaseID:XB-GENE-994580 Length:483 Species:Xenopus tropicalis


Alignment Length:268 Identity:72/268 - (26%)
Similarity:111/268 - (41%) Gaps:55/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGI--PHNISERSVNAKLA---QNPWMAYLETPKGFH-CSGTLINHLFVLTAAHCVPDDLLI--- 84
            ||:  .:..|.|.|...::   |.||.|.| ..:|.| |.|:||...:::|||||| .|||.   
 Frog   232 CGLRPSYTSSARIVGGNVSAVGQWPWQASL-VFQGVHLCGGSLITPQWIVTAAHCV-YDLLYPEW 294

  Fly    85 -TVRLGEY-----NTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYL 143
             .|::|:.     :.:|.|         |.|:.     ..|..|.::...|||.::||.....:.
 Frog   295 WRVQVGQVSQASESAQTAV---------PVQKI-----IYHSKYRSSTMANDIALIRLASPFTFN 345

  Fly   144 NHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANA-TSKVLRTMNIDRQPKETCSE--IYGWNM 205
            ..|:|||: .:.|...|..::.|.:.  |..|.... ||:.:....:.......|:.  |||..:
 Frog   346 GSIQPICL-PNYREDFPEGKICWISG--WGATEEGGDTSQTMDYAGVPLISNRVCNTKYIYGGVI 407

  Fly   206 TFEQICAG------NTLSQLCSTDSGAP---QIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMD 261
            ....:|||      :|    |..|||.|   :...:|.........:|.|.|.|     .|:...
 Frog   408 KPSMVCAGFLEGGVDT----CQGDSGGPLACEDSNVWKLMGTTSWGIGCALRYK-----PGVYTR 463

  Fly   262 LLSYADWI 269
            :.|:.|||
 Frog   464 ISSFLDWI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/244 (27%)
Tryp_SPc 48..269 CDD:214473 64/242 (26%)
tmprss3XP_031752328.1 LDLa 96..128 CDD:197566
SRCR_2 136..236 CDD:406055 2/3 (67%)
Tryp_SPc 244..472 CDD:238113 68/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.