DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Mcpt1l1

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001264597.1 Gene:Mcpt1l1 / 100360872 RGDID:2321286 Length:260 Species:Rattus norvegicus


Alignment Length:260 Identity:67/260 - (25%)
Similarity:108/260 - (41%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 MLLEEDCGIPHNISERSVNAKLAQNPWMAYLE--TPKGFH--CSGTLINHLFVLTAAHCVPDDLL 83
            :||....|....|.  .|.::....|:||:||  |.:|:.  |.|.|:...||:|||||...:  
  Rat    10 LLLPSGAGAEEIIG--GVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRE-- 70

  Fly    84 ITVRLGEYN-TKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIR 147
            .||.||.:: :||         :...|:..|:....|..||.....:||.:|:|.::.:....:.
  Rat    71 TTVTLGVHDVSKT---------ESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVD 126

  Fly   148 PICIFASNRFQEPIDQLTWFTTTVWRET-AANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQIC 211
            .|.:...:.|.:|....   ....|.:| ....||..||.:......||.|...:.:|..| |:|
  Rat   127 VIPLPQPSDFLKPGKMC---RAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNF-QVC 187

  Fly   212 AGN--TLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRVVR 274
            .|:  .:......|||.|.:        ...|..||.|..:|..:...:...:..|..||.:|::
  Rat   188 VGSPRKIRSAYKGDSGGPLV--------CAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIK 244

  Fly   275  274
              Rat   245  244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/231 (26%)
Tryp_SPc 48..269 CDD:214473 59/228 (26%)
Mcpt1l1NP_001264597.1 Tryp_SPc 20..239 CDD:214473 61/243 (25%)
Tryp_SPc 21..242 CDD:238113 63/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.