DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and tmprss12

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_031751504.1 Gene:tmprss12 / 100127698 XenbaseID:XB-GENE-964846 Length:324 Species:Xenopus tropicalis


Alignment Length:269 Identity:78/269 - (28%)
Similarity:113/269 - (42%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QMLLEEDCGIP---HNISERSV---NAKLAQNPW---MAYLETPKGF--HCSGTLINHLFVLTAA 75
            |.:..|.||.|   |....|.|   ||.....||   :.|..|..|:  .|.|:||.:.:||:||
 Frog    21 QAIDSEVCGEPPLVHTPGSRIVGGRNALPGAWPWQVSLQYFRTLSGYSHRCGGSLIQNNWVLSAA 85

  Fly    76 HCVPDDLLITVRLGEYNTKTKVDCDNHLCQ-EPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRR 139
            ||...:     |..|| .:..:...|...: .|..:..:.....|..|:....||||.:|.|...
 Frog    86 HCFRAN-----RNPEY-WRAVLGLHNIFMEGSPVVKAKIKQIIIHASYDHIAITNDIALLLLHDF 144

  Fly   140 VEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANAT-SKVLRTMNIDRQPKETCSEIYGW 203
            |.|.::|.|:|:   .....| |.||....|.|..|....: |.:|:...:...|...|:....:
 Frog   145 VTYSDYIHPVCL---GSVTVP-DSLTACFITGWGVTKEKGSISVILQEALVQTIPYSECNSSSSY 205

  Fly   204 N--MTFEQICAGNTLSQL--CSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQN---SGILMD 261
            |  :|...||||:....:  |..|||.|.:  .::....|:.|:||.|...| |..   .|:...
 Frog   206 NGFITQSMICAGDNSGAVDSCQGDSGGPFV--CYNTERMRFYQMGITSFGYG-CGKPNFPGVYTK 267

  Fly   262 LLSYADWIK 270
            :.||..|||
 Frog   268 VESYVSWIK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 68/237 (29%)
Tryp_SPc 48..269 CDD:214473 65/234 (28%)
tmprss12XP_031751504.1 Tryp_SPc 41..278 CDD:238113 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.