DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and plaua

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:343 Identity:68/343 - (19%)
Similarity:113/343 - (32%) Gaps:99/343 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ICCLWRRVQGFQ-----------------------------MLLEEDCGIPH------------- 33
            ||..|..:||.:                             ..:.|.|.||.             
Zfish    79 ICAPWNSIQGSRYSAFKNCYHNYCRNPDDWTQPWCVVKKRNRYVREYCNIPQEAIKPVKRPPTPE 143

  Fly    34 --------NISER----------SVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPD 80
                    ...||          .:.:.:...||||.:....||.|.||||...:|||||||.|.
Zfish   144 PIKQDTELTCGERRLDRQTKIIGGLRSTVESQPWMAAIFKGDGFICGGTLITPCWVLTAAHCFPT 208

  Fly    81 DLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHR--YYNANDQTNDIGMLRL----GRR 139
            ..  ..::..|:.....:..|.......|::.|.....|.  .|:..:.|:||.:|::    |:.
Zfish   209 GK--RTQINRYSVVLGKNAINETDPVKEQKFTVSRLVIHEDFDYSTENYTHDIALLKIEDCNGQC 271

  Fly   140 VEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANAT--------SKVLRTMNIDRQPKET 196
            ......:|..|:       .|..|:  .....:.|.|....        |:.|:...:....::.
Zfish   272 AVKTKTVRTACL-------PPFQQM--LPVGFYCEIAGYGRYQKGTFKFSRYLKQTEVKLISQKV 327

  Fly   197 CSEIYGWN---MTFEQICAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC--- 253
            |...| :|   :....:||.  :..:..|..|||.|.:.::    ::.....||.|..| :|   
Zfish   328 CQRTY-YNKDEVNENMLCANGRDWKTDACQGDSGGPLVCEV----NNIMFLFGIISWGK-ECAEK 386

  Fly   254 QNSGILMDLLSYADWIKR 271
            ...|:...:.:|..||.:
Zfish   387 NQPGVYTQVSNYNQWISQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 57/246 (23%)
Tryp_SPc 48..269 CDD:214473 55/242 (23%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.