DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and LOC100004411

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_001343728.4 Gene:LOC100004411 / 100004411 -ID:- Length:494 Species:Danio rerio


Alignment Length:273 Identity:72/273 - (26%)
Similarity:117/273 - (42%) Gaps:48/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NISERSVNAKLAQ---NPWMAYL--ETPKGFHCSGTLINHLFVLTAAHCV---PDDLLITVRLGE 90
            |...|.|..:|.:   :||...|  |...|| |.|:|||..:|:|||||:   |..:.|    |:
Zfish   244 NEDTRIVGGQLQRQGGSPWQVLLRREDEYGF-CGGSLINQRWVITAAHCLQQTPHHITI----GD 303

  Fly    91 YNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASN 155
            |: |.:.|.|.       |:..|:....|.:|:.....:||.:|.|...|.......|.|:..:|
Zfish   304 YD-KMRPDKDE-------QKITVEKIIPHPHYHEYTFDSDIALLYLSSAVTLGPFASPACLPDAN 360

  Fly   156 ---RFQEPIDQLTWFTTTVWRET-AANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTL 216
               |..:|.:|   ...:.|..| ....:|:.||.:.:....:::|.......:|....|||..:
Zfish   361 LAERLMKPGEQ---GLVSGWGSTHYLQRSSRFLRKVQLPVVEQKSCINSTEQIITDNMFCAGFLM 422

  Fly   217 SQL--CSTDSGAPQI---RKMWHNGSDRYVQLGIASRVKGQCQNS---GILMDLLSYADWI---- 269
            .::  |:.|||.|.|   |..|       ...|:.|..: :|.:.   |:...|.:|..||    
Zfish   423 EEMDACTGDSGGPFIVNYRGTW-------FLTGVVSWGE-RCASQGKYGVYTRLGNYLSWIQEEM 479

  Fly   270 KRVVRQYGPSTDM 282
            |:..:|.|.:.::
Zfish   480 KKEEKQSGVTAEV 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/244 (27%)
Tryp_SPc 48..269 CDD:214473 63/237 (27%)
LOC100004411XP_001343728.4 GLA 22..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 128..164 CDD:291342
Tryp_SPc 248..475 CDD:214473 66/250 (26%)
Tryp_SPc 249..477 CDD:238113 67/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.