DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and tmprss3a

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:247 Identity:59/247 - (23%)
Similarity:96/247 - (38%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVNAKLA---QNPWMAYLETPKGFHCSGTLINHLFVLTAAHCV-----PDDLLIT 85
            ||.....|.|.|...|:   |.||...|.......|.|::|...::|||||||     |...::.
Zfish   288 CGSRPKFSARIVGGNLSAEGQFPWQVSLHFQNEHLCGGSIITSRWILTAAHCVYGIAYPMYWMVY 352

  Fly    86 VRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPIC 150
            ..|.|            |.....:.:.|:....|..|......:||.:::|.:.:.:...:.|||
Zfish   353 AGLTE------------LPLNAVKAFAVEKIIYHSRYRPKGLDHDIALMKLAQPLTFNGMVEPIC 405

  Fly   151 IFASNRFQEPID--QLTWFTTTVWRETAANATSKVLR-TMNIDRQPKETCS--EIYGWNMTFEQI 210
            :   ..|.|..:  ::.|.:.  |..|.....:.|.: ..::.....:.||  |:|...:|...|
Zfish   406 L---PNFGEQFEDGKMCWISG--WGATEDGGDASVSQHCASVPLISNKACSQPEVYQGYLTAGMI 465

  Fly   211 CAG--NTLSQLCSTDSGAP------QIRKM-----WHNGSDRYVQLGIASRV 249
            |||  :..:..|..|||.|      .|.|:     |..|.....:.|:.:|:
Zfish   466 CAGYLDGGTDSCQGDSGGPLACEDSSIWKLVGATSWGQGCAEKNKPGVYTRI 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 52/225 (23%)
Tryp_SPc 48..269 CDD:214473 52/225 (23%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845 2/3 (67%)
Tryp_SPc 298..525 CDD:238113 55/237 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.