DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG18754

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:303 Identity:84/303 - (27%)
Similarity:123/303 - (40%) Gaps:76/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VFLEENCGVVPRLSYKIIN---------------------GTP---------ARLGRYPWMAFLH 60
            ||....||:.|. .:::::                     .||         |.|..||||..|.
  Fly    61 VFAHRQCGLDPN-GHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLL 124

  Fly    61 TPTYFLCAGSLINQWFVLTSAHCI------EDDVEL-IARLGENNRDNDIDC--ENNRCLEATQE 116
            .....    |||.  :|||:|||:      ::|:.| ..||||:.    .||  ..:||.....|
  Fly   125 YENRL----SLIR--YVLTAAHCVIGGYLTQNDLVLKSVRLGEST----TDCITSESRCPHLDVE 179

  Fly   117 YNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICI----FHHRRMQLVVDQITWFKATG 177
            .....:.:........:.|||.:|||:..|.||..|||||:    |..:.:.|.:        :|
  Fly   180 VGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQI--------SG 236

  Fly   178 WGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGND-DGNLCRGDSGGP-QGRY 240
            |.      .||||:.|:...:..|...||...:.....:.|:|||.. .|:.|.|.||.| .|  
  Fly   237 WD------PTKSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMG-- 293

  Fly   241 VLIFGMKRFVQM-GIASFTYENCSKVSI---LTDVVRYGRWIK 279
            ::..|:..||.: ||||:..:.|....|   .|.:..:..|||
  Fly   294 IMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 76/285 (27%)
Tryp_SPc 42..281 CDD:238113 79/287 (28%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 5/23 (22%)
Tryp_SPc 108..338 CDD:238113 77/255 (30%)
Tryp_SPc 108..335 CDD:214473 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.