DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:309 Identity:68/309 - (22%)
Similarity:117/309 - (37%) Gaps:94/309 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALFVLGVHGSSSVFLEENCGVVP------RLSYKIINGTPARLGRYPW---MAFLHTPTYFLCA 68
            |....|.|..::::...|. .:||      ::..:|.||.||..|:.|:   :.|.....:: |.
  Fly     4 LVFLALAVAAATAIPTPEQ-KLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWW-CG 66

  Fly    69 GSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDF 133
            ||:|...:|||:|||......:....|.:.|:..         :.|.........:|..|:..:.
  Fly    67 GSIIGNTWVLTAAHCTNGASGVTINYGASLRNQP---------QYTHWVGSGNFVQHHHYNSGNL 122

  Fly   134 SNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQIT--------------WFKATGWG----- 179
            .|||.::|       |.|:.    |.|     :|:::.              |..|:|||     
  Fly   123 HNDISLIR-------TPHVD----FWH-----LVNKVELPSYNDRYQDYAGWWAVASGWGGTYDG 171

  Fly   180 ------LTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDG-NLCRGDSGGP- 236
                  |.:.|:...|             ::||:|.:..:  ...||...:.| :.|.|||||| 
  Fly   172 SPLPDWLQAVDVQIMS-------------QSDCSRTWSLH--DNMICINTNGGKSTCGGDSGGPL 221

  Fly   237 ---QGRYVLIFGMKRFVQMGIASF-TYENCSK--VSILTDVVRYGRWIK 279
               :|..:          :|:.|| :...|..  .::.:.|..|..||:
  Fly   222 VTHEGNRL----------VGVTSFVSSAGCQSGAPAVFSRVTGYLDWIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 60/272 (22%)
Tryp_SPc 42..281 CDD:238113 62/274 (23%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 60/272 (22%)
Tryp_SPc 38..262 CDD:238113 62/274 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.