DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG11843

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:281 Identity:86/281 - (30%)
Similarity:131/281 - (46%) Gaps:54/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ENCGVVPRLSYK--IINGTPARLGRYPWMAFL------HTPTYFLCAGSLINQWFVLTSAHCIED 86
            :||     .||.  |:.|.||:...:|.||.|      .:...:.|.|.||::.||||:|||:|.
  Fly    59 DNC-----RSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLES 118

  Fly    87 ---DVELIARLGENNRDN-DIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVE 147
               :|.:: ||||.:.|: |.|.       |.::|.|.....|..|:...|.:|||:::|...|.
  Fly   119 ERGEVNVV-RLGELDFDSLDEDA-------APRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVV 175

  Fly   148 YTYHIQPICI-FHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARI-- 209
            :..:..|.|: |...|..   |.   |.|.|||  ||.|..|.|..|:::.|.|.....|.::  
  Fly   176 FDLYKHPACLPFQDERSS---DS---FIAVGWG--STGLALKPSAQLLKVKLQRYGNWVCKKLLT 232

  Fly   210 -----FKQNF-LSGQICAGNDDG-NLCRGDSGGPQGRYVLIFGMK---RFVQMGIASFTYENCSK 264
                 |.:.| .:.|:|.|::.. :.|.||||||    :|::..:   .:|.:||.|... :|..
  Fly   233 RQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGP----LLMYHREYPCMYVVVGITSAGL-SCGS 292

  Fly   265 ---VSILTDVVRYGRWIKKVV 282
               ..|.|.|..|..||.:.:
  Fly   293 PGIPGIYTRVYPYLGWIARTL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 80/264 (30%)
Tryp_SPc 42..281 CDD:238113 82/264 (31%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 82/264 (31%)
Tryp_SPc 68..309 CDD:214473 80/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.