DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and grass

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:284 Identity:91/284 - (32%)
Similarity:145/284 - (51%) Gaps:37/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HGSS--SVFLEEN--CGVVPRLSYKIINGTPARLGRYPWMAFLHTPTY----FLCAGSLINQWFV 77
            |.|.  |:|.:||  ||..  ||.::.||...:|...||||.|....:    |||.|::|::.::
  Fly    96 HNSKVMSLFKDENFDCGNF--LSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYI 158

  Fly    78 LTSAHCI---EDDVELIARLGENNRDNDIDC----ENNRCLEATQEYNVDMLFKHRLYDPKDFSN 135
            ||:|||:   ::|:..| ||||:....:.||    ...:|........::....|..||.:...:
  Fly   159 LTAAHCVHGLQNDLYEI-RLGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMH 222

  Fly   136 DIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYR 200
            ||.:|:|.|.|.:..||:|||:.....::...:||:.:..||||.|.   |..||.||::.|:..
  Fly   223 DIALLKLNRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTE---NGSSSDVLLQANVPL 284

  Fly   201 RPRNDCARIFKQNFLSGQICAGNDD-GNLCRGDSGGP-------QGRYVLIFGMKRFVQMGIASF 257
            :||:.|::.:::.....|:|.|..| .:.|:||||||       .|.|.     .:.|:.||.|.
  Fly   285 QPRSACSQAYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYA-----PKMVEFGIVSQ 344

  Fly   258 TYENCSKVS---ILTDVVRYGRWI 278
            ....|.::|   :.|:|..|.:||
  Fly   345 GVVTCGQISLPGLYTNVGEYVQWI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 79/258 (31%)
Tryp_SPc 42..281 CDD:238113 81/259 (31%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 81/257 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.