DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and SPE

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:280 Identity:84/280 - (30%)
Similarity:123/280 - (43%) Gaps:35/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CGVVPRLSYKIINGTPARLGRYPWMAFLH-----TPTY-FLCAGSLINQWFVLTSAHCI---EDD 87
            ||.:  .:.:|..||...|..:|||..|.     :.|| |.|.|:|:|..:|||:.||:   |.|
  Fly   127 CGFL--FADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELD 189

  Fly    88 ----VELIARLGENNRDNDIDCENNR-----CLEATQEYNVDMLFKHRLYDPK--DFSNDIGMLR 141
                |....||||.:...|.||....     |.....:..|:....|.:|.|.  |..|||.::|
  Fly   190 KSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVR 254

  Fly   142 LERRVEYTYHIQPICIFHHRRMQ-LVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRND 205
            |:|.|.||.:::|||:.....:| ..||.  .....|||||.   |.:.|.:.:::.:.......
  Fly   255 LKRIVSYTDYVRPICLPTDGLVQNNFVDY--GMDVAGWGLTE---NMQPSAIKLKITVNVWNLTS 314

  Fly   206 CAR---IFKQNFLSGQICAGNDDG-NLCRGDSGGPQGRYVLIFGMKRFVQMGIASFTYENCSK-- 264
            |..   .||......|:|||...| :.|.||||||....:...|...|...|:.|:..:.|..  
  Fly   315 CQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKG 379

  Fly   265 -VSILTDVVRYGRWIKKVVD 283
             ..:.|....:..|||:.::
  Fly   380 WPGVYTRTGAFIDWIKQKLE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 79/264 (30%)
Tryp_SPc 42..281 CDD:238113 82/266 (31%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 82/266 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463496
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.