DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG16710

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:288 Identity:89/288 - (30%)
Similarity:137/288 - (47%) Gaps:63/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CG-VVPRLSYKIINGTPARLGRYPWMAFL----------HTPTYFLCAGSLINQWFVLTSAHCIE 85
            || ::|  :|:|..|...:....||||.:          :......||||||...:|||:|||:.
  Fly    97 CGPIMP--AYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLR 159

  Fly    86 D---DVELIARLGENNRDNDIDCE---NNR--CLEATQEYNVDMLFKHR---LYDPKDFSNDIGM 139
            .   |:..: ||||:|..::.||.   |.|  |.....|.:||:..|||   :::.:.: |||.:
  Fly   160 ITGLDLRRV-RLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPY-NDIAL 222

  Fly   140 LRLERRVEYTYHIQPICI----------FHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLM 194
            |||:..|.||..|:|||:          |.:.::|:          .||||:.   ....|.||:
  Fly   223 LRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQI----------AGWGLSH---KQGYSNVLL 274

  Fly   195 ELNLYRRPRNDCA------RIFKQNFLSGQICAGNDDGN-LCRGDSGGPQGRYVLIFGMKRFVQM 252
            :..:..|..::|:      .:.|:.    .|||||..|| .|:||||||. ..::..|.:.||.:
  Fly   275 QAYVNGRNADECSLSEPSLGLDKET----HICAGNLGGNDTCKGDSGGPL-MAIMERGDEEFVYL 334

  Fly   253 -GIASFTYENCS-KVSILTDVVRYGRWI 278
             ||.|:.|..|. ..:..|...::..||
  Fly   335 AGITSYGYSQCGYGPAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 83/276 (30%)
Tryp_SPc 42..281 CDD:238113 85/277 (31%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 83/276 (30%)
Tryp_SPc 106..362 CDD:238113 83/275 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.