DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG31199

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:221 Identity:48/221 - (21%)
Similarity:80/221 - (36%) Gaps:53/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IAYLALFVLGVHG---SSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFL----- 66
            ||.|.|.| |:.|   .|:...::.||.........:..|.|....:.|:|.:.....|.     
  Fly     5 IAVLLLLV-GLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKIRD 68

  Fly    67 --CAGSLINQWFVLTSAHCIEDDVE-------LIARLGENNRDNDID---CE-NNRCLEATQEYN 118
              |.|.|:::..||..|||.   |:       ....||.:|:...:.   || :..|:..:||..
  Fly    69 NGCLGVLVSKRTVLAPAHCF---VQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIK 130

  Fly   119 VDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPIC----------------------IFHHR 161
            :..:..|..||.:...|.:.:|.|:|..:...::.|||                      :|...
  Fly   131 LAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFEDF 195

  Fly   162 RMQLVVDQITWFKATGWGLTSTDLNT 187
            |::      ||......|...:.:.|
  Fly   196 RLK------TWVNTLSRGFCQSKVKT 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 38/187 (20%)
Tryp_SPc 42..281 CDD:238113 38/186 (20%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 37/180 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.