DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG4053

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:264 Identity:72/264 - (27%)
Similarity:110/264 - (41%) Gaps:60/264 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LSYKIINGTPARLGRYPWMAFLHT--PTYFLCAGSLINQWFVLTSAHCIED----DVELIARLGE 96
            |..:|:.|..|..|..|:...:.|  .|: :|:|.::|:.::||:.||..|    |:.:|  :|.
  Fly    31 LDNRIVGGQEAEDGVAPYQVSIQTIWKTH-ICSGVILNEQWILTAGHCALDFSIEDLRII--VGT 92

  Fly    97 NNRDNDIDCENNRCLEATQEYNVDMLFKHRLYD-PKDFSNDIGMLRLERRVEYTYHIQPICIFHH 160
            |:|           ||..|....|....|.||| |..::|||.::          |:....||:.
  Fly    93 NDR-----------LEPGQTLFPDEALVHCLYDIPYVYNNDIALI----------HVNESIIFND 136

  Fly   161 RR--MQLVVDQ------ITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCAR--IFKQNFL 215
            |.  ::|..:|      :|   .||||...:...|  .:.|..|||......:|..  .|.....
  Fly   137 RTQIVELSREQPPAGSTVT---LTGWGAPESSYPT--VQYLQTLNLTIIAHEECRERWDFHDGID 196

  Fly   216 SGQICAGNDDG-NLCRGDSGGP---QGRYVLIFGMKRFVQMGIASFTYENCSKVSILTDVVRYGR 276
            .|.||....:| ..|.||||||   :|:.|.:....|...:|:... |.|         .|.|..
  Fly   197 IGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNWGRACGVGMPDM-YAN---------TVYYQD 251

  Fly   277 WIKK 280
            ||::
  Fly   252 WIRR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 69/257 (27%)
Tryp_SPc 42..281 CDD:238113 71/260 (27%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 69/257 (27%)
Tryp_SPc 35..256 CDD:238113 71/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.