DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and modSP

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:240 Identity:57/240 - (23%)
Similarity:95/240 - (39%) Gaps:62/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EENCG--VVPRLSYK----IINGT--PARLGRYPWMAFLHTPT--YFLCAGSLINQWFVLTSAHC 83
            |::||  ..|...:.    .||.|  |..:|.|.|    |...  :|.|.|||:....|:|:|||
  Fly   355 EQDCGQLATPIKQFSSGGYTINNTVVPWHVGLYVW----HNEKDYHFQCGGSLLTPDLVITAAHC 415

  Fly    84 IEDD---------------VELIARLGE---NNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDP 130
            :.|:               .:.....||   ..:..|:     |.:|....|      |.|   .
  Fly   416 VYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDV-----RLIEIAPGY------KGR---T 466

  Fly   131 KDFSNDIGMLRLERRVEYTYHIQPICI----FHHRRMQLVVDQITWFKATGWGLTSTDLNTKSSR 191
            :::..|:.:|.|:...|.::.|:|||:    |..:  :.|.|.:.. |..||       |.::..
  Fly   467 ENYYQDLALLTLDEPFELSHVIRPICVTFASFAEK--ESVTDDVQG-KFAGW-------NIENKH 521

  Fly   192 VLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDGNL-CRGDSGG 235
            .|..:....:..:.|.|..: :..:.:.|......:| |:|||||
  Fly   522 ELQFVPAVSKSNSVCRRNLR-DIQADKFCIFTQGKSLACQGDSGG 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 53/226 (23%)
Tryp_SPc 42..281 CDD:238113 53/221 (24%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 53/224 (24%)
Tryp_SPc 371..591 CDD:304450 53/224 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.