DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33461 and CG31326

DIOPT Version :9

Sequence 1:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:266 Identity:72/266 - (27%)
Similarity:115/266 - (43%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IINGTPARLGRYPWMAFL------HTPTYFLCAGSLINQWFVLTSAHCIE---DDV---ELIARL 94
            |..|...:.|:.||:..:      :.|. |:|.|:||:...||::|||..   .|:   .|...|
  Fly   274 IFQGKSLQRGQLPWLVAIFERRESNGPA-FICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSL 337

  Fly    95 GENNRDNDIDCENNRCLEATQEY-NVDMLFKHRLYDPKDFSN-DIGMLRLERRVEYTYHIQPICI 157
            |          .|...:.:..|: .|..|..|..:..|.|:. |:.::||:..|.||.:|.|||:
  Fly   338 G----------RNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICL 392

  Fly   158 FH-HRRMQLVVDQITWFKATGWGLTSTDL-NTKSSRVLMELNLYRRPRNDCA----RIFKQNFLS 216
            :. ..||.|.....::  ..|||...|.. ||:.|:| .:||:....  :||    .:..|   .
  Fly   393 WSTSNRMDLPQGLKSY--VAGWGPDETGTGNTEVSKV-TDLNIVSEA--NCALELPHVLVQ---P 449

  Fly   217 GQICAGNDDGNLCRGDSGGP-----QGRYVLIFGMKRFVQMGIASFTYENC--SKVSILTDVVRY 274
            ..:||.......|..|.|||     |..:||    :..:..|:.:.....|  ||.|:.|||.::
  Fly   450 SSLCAKKTGAGPCASDGGGPLMLREQDVWVL----RGVISGGVINEKENTCELSKPSVFTDVAKH 510

  Fly   275 GRWIKK 280
            ..|:::
  Fly   511 IEWVRQ 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 71/262 (27%)
Tryp_SPc 42..281 CDD:238113 72/266 (27%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 71/263 (27%)
Tryp_SPc 277..514 CDD:214473 70/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.